Кароковеин

Rec. INN (наименование, зарегистрированное ВОЗ)

2762666-72-6

severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) Spike (S) glycoprotein (S glycoprotein, UniProt P0DTC2), stable prefusion conformation variant (R⁶⁶⁹>G, R⁶⁷⁰>S, R⁶⁷²>S, K⁹⁷³>P, V⁹⁷⁴>P), C-terminal transmembrane domain (1196-1260) deleted and replaced with the ¹¹⁹⁶GSGYIPEAPRDGQAYVRKDGEWVLLSTFLGRSLEVLFQ¹²³³ peptide containing the enterobacteria phage T4 fibritin C-terminal foldon domain fragment ⁴⁵⁸GYIPEAPRDGQAYVRKDGEWVLLSTFL⁴⁸⁴, followed by the remnant of a human rhinovirus (HRV) 3C protease cleavage sequence (¹²²⁸LEVLFQ¹²³³), trimer, produced in Chinese hamster ovary (CHO) cells, cell line CHO-S, glycoform alfa

Поделиться этой страницей